My.. Tree. - A van parked next to a body of waterSimilarPictures from the Nye area - Montana folklife collectionFishlake and Southern UT (11937548975)vrachtwagens, chauffeurs, water - Automobiles of 1940sTeklanika 091 (24680664508)Wanted Information about The White Buses - 12745615033Wanted: Information about The White Buses.MoreRelatedTree near body of water - Public domain image. Dry plate negative.Trees by a body of water postcardA body of water by a road, trees in betweenBody of water seen through treesBody of water seen through treesTree-lined road by a body of waterMoreMy.. Tree. - A van parked next to a body of waterrate_reviewdescriptionSummarylabel_outlineTagstreeautomotive parking lightskywheelvehicletireplantautomotive lightingvanchevrolet g series vanschevrolet sportvanmotor vehiclechevroletengineoff road vehiclervcar plantcopyrightCopyright infoPublic Domain
